Bulk Boys Warehouse

The Complete Guide to Tracking: Concealment, Night Movement, and All Forms of Pursuit Following Tracks, Trails and Signs, Using 22 SAS Techniques

The Complete Guide to Tracking: Concealment, Night Movement, and All Forms of Pursuit Following Tracks, Trails and Signs, Using 22 SAS Techniques

Complete Guide to Tracking. New. Mint Condition. Dispatch same day for order received before 12 noon. Guaranteed packaging. No quibbles returns.

CompleteGuideTrackingConcealmentNightMovementFormsPursuitFollowingTracksTrailsSignsUsing22SASTechniques

£9.99

See Offer
Motorbike GPS Tracker Compact Genuine TK102 NANO Magnetic Car Tracking Device

Motorbike GPS Tracker Compact Genuine TK102 NANO Magnetic Car Tracking Device

REWIRE SECURITY 102-NANO REAL TIME MAGNETIC SELF POWERED GPS TRACKER Keep track of your family members, employees or anyone you need to monitor, with the 102-Nano GPS tracker from Rewire Security, one of the smallest GPS trackeing devices available. Even with its small compact design the 102nano does not lack on function or features, with the ability to track by turn or distance with updates from as little as every 10 seconds up to 15 minutes. The 102nano can also be used as a simple to use SMS

MotorbikeGPSTrackerCompactGenuineTK102NANOMagneticTrackingDevice

£ 39.49

See Offer
New Car GPS Tracker TK102 B Magnetic Vehicle Spy Mini Personal Tracking Device

New Car GPS Tracker TK102 B Magnetic Vehicle Spy Mini Personal Tracking Device

TK102B Car Realtime GPS Tracker Personal Tracking Device + Magnetic Cover Introduction:• Works well even in areas with limited sky view like urban canyons. GSM/SMS communication or GPRS TCP/UDP connection. Works worldwide! Locate the locator holder by the mobile phone via SMS. Support checking location by SMS and Internet. Support SD Card.Features:• Build-in GPS personal locator. • GSM/SMS communication or GPRS TCP/UDP connection. Works worldwide! • High sensitivity, New technology and latest GP

GPSTrackerTK102MagneticVehicleMiniPersonalTrackingDevice

£ 12.95

See Offer
Mini Realtime Car GPS GSM Tracker Locator Vehicle/Van Personal Tracking Device

Mini Realtime Car GPS GSM Tracker Locator Vehicle/Van Personal Tracking Device

Mini Realtime Car GPS GSM Tracker Locator Vehicle/Van Personal Tracking DeviceOverview: The realtime GPS GPRS GSM tracker for car/vehicle/motorcycle tracking device spy , to achieve real-time vehicle location tracking, text messages and computer services platform to support location identification. Features: 100% brand new and high quality GSM quad-band systems worldwide Wide input voltage range: 9-36VDC Built-in overspeed alarm?to remind speeding Achieve real-time vehicle location tracking, tex

MiniRealtimeGPSGSMTrackerLocatorVehicle/VanPersonalTrackingDevice

£ 14.95

See Offer
TK102 GPS Tracker Magnetic Car Vehicle Spy Personal Realtime Tracking Device new

TK102 GPS Tracker Magnetic Car Vehicle Spy Personal Realtime Tracking Device new

TK102 GPS Tracker Magnetic Car Vehicle Spy Personal Realtime Tracking Device new Overview: Works well even in areas with limited sky view like urban canyons.GSM/SMS communication or GPRS TCP/UDP connection. Works worldwide! Locate the locator holder by the mobile phone via SMS. Support check location by SMS and Internet.Support SD Card. Very Low power consumption. Features: 100% Brand new and high quality Build-in GPS personal locator. GSM/SMS communication or GPRS TCP/UDP connection. Works worl

TK102GPSTrackerMagneticVehiclePersonalRealtimeTrackingDevice

£ 13.95

See Offer
104-PRO Gps Tracker Tracking System Car Vehicle Hidden Tracker Magnetic TK104

104-PRO Gps Tracker Tracking System Car Vehicle Hidden Tracker Magnetic TK104

REWIRE SECURITY 104-PRO REAL TIME MAGNETIC SELF POWERED GPS TRACKER MULTI PURPOSE FOR CAR, MOTORBIKE, ASSET, TRUCK, VAN, LORRY, FLEET TRACKING GENUINE REWIRE SECURITY GPS TRACKING DEVICE ALARMS : SHOCK SENSOR ALARM, MOVEMENT ALARM, VIRTUAL GEO-FENCE ALARM, DOOR ALARM, SOS ALARM, OVERSPEED ALARM, POWER OFF ALARM, SOS ALARM DUAL GPS (GLOBAL POSITIONING SYSTEM) TRACKING AND LBS (LOCATION BASED SERVICE/GSM) TRACKING SUPPORT 4 DIFFERENT SLEEP MODES FOR INCLUDING NEW DEEP SLEEP FEATURE STRONG MAGNETIC

104-PROTrackerTrackingSystemVehicleHiddenMagneticTK104

£ 79.99

See Offer
Genuine GPS Tracker Magnetic Car Vehicle Personal Tracking Device 102-NANO TK102

Genuine GPS Tracker Magnetic Car Vehicle Personal Tracking Device 102-NANO TK102

REWIRE SECURITY 102-NANO REAL TIME MAGNETIC SELF POWERED GPS TRACKER Keep track of your family members, employees or anyone you need to monitor, with the 102-Nano GPS tracker from Rewire Security, one of the smallest GPS trackeing devices available. Even with its small compact design the 102nano does not lack on function or features, with the ability to track by turn or distance with updates from as little as every 10 seconds up to 15 minutes. The 102nano can also be used as a simple to use SMS

GenuineGPSTrackerMagneticVehiclePersonalTrackingDevice102-NANOTK102

£ 39.99

See Offer
Covert Magnetic Gps Tracker TK104 Tracking Device Car Vehicle Spy Hidden -104

Covert Magnetic Gps Tracker TK104 Tracking Device Car Vehicle Spy Hidden -104

REWIRE SECURITY 104-PRO REAL TIME MAGNETIC SELF POWERED GPS TRACKER MULTI PURPOSE FOR CAR, MOTORBIKE, ASSET, TRUCK, VAN, LORRY, FLEET TRACKING GENUINE REWIRE SECURITY GPS TRACKING DEVICE ALARMS : SHOCK SENSOR ALARM, MOVEMENT ALARM, VIRTUAL GEO-FENCE ALARM, DOOR ALARM, SOS ALARM, OVERSPEED ALARM, POWER OFF ALARM, SOS ALARM DUAL GPS (GLOBAL POSITIONING SYSTEM) TRACKING AND LBS (LOCATION BASED SERVICE/GSM) TRACKING SUPPORT 4 DIFFERENT SLEEP MODES FOR INCLUDING NEW DEEP SLEEP FEATURE STRONG MAGNETIC

CovertMagneticTrackerTK104TrackingDeviceVehicleHidden-104

£ 79.99

See Offer
Garmin - Alpha 100 3" Multidog Tracking GPS

Garmin - Alpha 100 3" Multidog Tracking GPS

Garmin - Alpha 100 3" Multidog Tracking GPS

GarminAlpha100MultidogTrackingGPS

$ 599.99

See Offer
The Young Scientists Club - Science on a Tracking Expedition Kit - Multi

The Young Scientists Club - Science on a Tracking Expedition Kit - Multi

The Young Scientists Club - Science on a Tracking Expedition Kit - Multi

YoungScientistsClubScienceTrackingExpeditionMulti

$ 24.25

See Offer
Wheel Alignment/Tool/Tracking Gauge Dished turnplates

Wheel Alignment/Tool/Tracking Gauge Dished turnplates

UNIVERSAL DISHED TURNPLATES MADE FROM 4MM STEEL and FINISHED IN A THICK SILVER-GREY POWDER COAT to prevent rusting. Please note that you cannot pasavate mild steel and any claims that you can are wrong & misleading! Please google this!There is also a small hole for hanging on a wall using a cup hook (provided). CAN BE USED WITH ALL MECHANICAL WHEEL ALIGNMENT EQUIPMENT MADE IN ROTHERHAM/SHEFFIELD Yorkshire PRICE IS FOR ONE PAIR Extra Postage charge for Islands and Highlands. PAYMENT DETAILS: PAYM

WheelAlignment/Tool/TrackingGaugeDishedturnplates

£ 20.00

See Offer
Olympus T100 Blue 12MP Digital Camera, 3x Optical Zoom, 2.4" LCD, AF Tracking, Creative Art Filters

Olympus T100 Blue 12MP Digital Camera, 3x Optical Zoom, 2.4" LCD, AF Tracking, Creative Art Filters

Olympus T100 Blue 12MP Digital Camera achieves superior image quality with a high-resolution, 12-megapixel CCD. Make large prints, or even crop, without losing any detail at all. The 3x optical zoom brings you closer to the subject without taking a step. There are 21 shooting modes built right in, so that you can photograph just about any kind of scene you'd like - everything from sports photography to macro photography and many other photo specialties in between. And if you feel the need for a little extra advice, the camera's on-board Help Guides will briefly describe the camera's features and settings at the touch of a button.

OlympusT100Blue12MPDigitalCameraOpticalZoom24LCDAFTrackingCreativeFilters

$ 79.00

See Offer
Bushnell - BackTrack 360413 Personal Tracking Device

Bushnell - BackTrack 360413 Personal Tracking Device

Bushnell - BackTrack 360413 Personal Tracking Device

BushnellBackTrack360413PersonalTrackingDevice

$ 54.62

See Offer
Deliveries Package Tracker

Deliveries Package Tracker

Keep track of all your parcels at a glance. 300+ supported couriers. Automated notifications for new statuses. Synchronization across devices.

DeliveriesPackageTracker

£0.00

See Offer
GOOME GM07W OBD GPS Tracker Mini Auto OBD Car GSM Vehicle Tracking Device Small Plug Play GPS Locator 1 year free trail

GOOME GM07W OBD GPS Tracker Mini Auto OBD Car GSM Vehicle Tracking Device Small Plug Play GPS Locator 1 year free trail

Goome aren't based on advertising hype, they sell by word of mouthGOOME GM07W GPS Tracker-Track Vehicles Anywhere! GM07W Functions:Location Accuracy:10 meters, 2D RMSReal time vehicle tracking. Support Google map location inquiry.APN Automatic Identification in your country GSM Chip:Quad Band GSM 850/900/1800/1900Mhz Goome Tracker Advantages:Multi domain access to ensure no single point of failureAPN adapted to most of the operator in the worldBroken-point continuingly-transferring, ensure the s. 1.Goome aren't based on advertising hype, we sell by word of mouth. 2. Associated with Caronline-15 millions user-most reliable platfrom with Web&App. 3.Web interface, iPhone&Android APP for real time monitoring, status reports. You can download the APP "car online" or log on the website : www.gpsoo.net for detailed information. Account is the IMEI NO. and the password is last 6 digits of IMEI No.. 4. No installation, no wiring harness, simply plugs into OBD port; OBD standard interface. 5. 1 year free trial for most stable and functional goome platform.

GOOMEGM07WOBDGPSTrackerMiniAutoGSMVehicleTrackingDeviceSmallPlugPlayLocatoryearfreetrail

£36.99

See Offer
Tracking the Hooligans: The History of Football Violence on the UK Rail Network

Tracking the Hooligans: The History of Football Violence on the UK Rail Network

'On an average Saturday, some thirty trains carried police escorts of between two and eight officers. Officers sometimes reached the destination with their uniforms soiled with spittle, and other filth, burnt with cigarette ends, or slashed.' Charting the history of violent acts committed by football hooligans on the British rail network and London Underground, numerous retired police officers offer a frightening, and often humorous, insight into how they battled 'the English disease'. Recalling.

TrackingHooligansHistoryFootballViolenceUKRailNetwork

£16.99

See Offer
GPS Tracker, LESHP GPS Tracking System with Real Time Tracking, SOS Alarm, 2-Way Voice, Spy Mode, Geo-Fence, Fall Detection, Speed Alert, GPS Tracking for Kids/ Seniors/ Personal

GPS Tracker, LESHP GPS Tracking System with Real Time Tracking, SOS Alarm, 2-Way Voice, Spy Mode, Geo-Fence, Fall Detection, Speed Alert, GPS Tracking for Kids/ Seniors/ Personal

Notice:THIS IS A 2G DEVICE. The perfect GPS tracking device for monitoring and protecting people and property. The GPS Tracker incorporates the following features: • SOS emergency alarm by text or two-way call to a pre-programmed number/s • Activated SOS alarm will text location details, with real time GPS tracking by satellite from online platform, log-in from anywhere for real-time GPS location updates. Location based on both GPS and cellular network (GSM only - AT&T or T-Mobile), users are . Location alerts with simple text commands - sends back Google maps location/address as well as Lat/Long coordinates to your phone,(Need 2G SIM card). Real time GPS tracking with online web portal using Google Maps; Call the GPS Tracker using the 'Silent Call' feature (SPY tracker mode) .For Users who have issue with the mobile and/or online tracking applications, please follow the set-up instructions that accompany the GPS Personal Alarm. Provide to an elderly person. This personal tracking device has a fall monitor, can track movement, can set perimeter boundaries (geo-fencing), and has an SOS button to push in the event of an emergency.. Place the GPS Tracking Device in your luggage or on pets collars - so you can track them from anywhere in the world to a few yards. Place in your car and set GPS system speed thresholds - sends text alerts to nominated numbers if speed exceeds the set value. SOS/Distress alarm will send text to (max 3) nominated numbers, and also calls (max 3) nominated numbers. It enables 2-way voice communication, just like a phone call. Protect yourself, your child, your car etc..

GPSTrackerLESHPTrackingSystemRealTimeSOSAlarm2-WayVoiceModeGeo-FenceFallDetectionSpeedAlertKids/Seniors/Personal

£128.99

See Offer
OUTAD 2-in-1 Vehicle GPS Trackers&Dual USB Car Charger,Save Parking Location,Locate Car GPS Tracking Mobile APP with LED Display Car Battery Voltage

OUTAD 2-in-1 Vehicle GPS Trackers&Dual USB Car Charger,Save Parking Location,Locate Car GPS Tracking Mobile APP with LED Display Car Battery Voltage

Features:  It adopts double USB interface design, can automatically identify all kinds of brand mobile phones/tablets, automatically select and output the best charging current ,the output is 4.2A. FIND YOUR CAR. Use the free for  iOS / android Map App to find where you parked your car in theme parks, shopping malls, stadiums, outdoor events and more (Need to work with phone compass) The product design of LED display screen, can be real-time display car battery voltage, charging current. It als. The product is a GPS tracking device that can track your car by mobile APP to know where your car park.The APP(The name is called:'Auto Locate')can be used to check the distance of the parking position. The compass can indicate the direction of your parking. It can also navigate your parking location in real time via the mobile map.. Car charger function:a smart quick car charger, compatible with all electronic devices with USB charging port.. Dual USB Ports:Charge 2 devices at the same time. LED Display:It can be real-time display car battery voltage, charging current. Linear Voltage Compensation Function:It can be effectively avoided your charging cable is too long influence on the speed of charging..

OUTAD2-in-1VehicleGPSTrackersDualUSBChargerSaveParkingLocationLocateTrackingMobileAPPLEDDisplayBatteryVoltage

£22.99

See Offer
Smart Fitness Tracker, Mpow Activity Tracker Heart Rate Monitor with 14 Exercise Modes Sleep Monitor with GPS Route Tracking Pedometer Step Counter with 4 Watch Faces for Android or iOS Smartphones

Smart Fitness Tracker, Mpow Activity Tracker Heart Rate Monitor with 14 Exercise Modes Sleep Monitor with GPS Route Tracking Pedometer Step Counter with 4 Watch Faces for Android or iOS Smartphones

Mpow Smart Fitness Tracker, the Ideal Christmas Gift for Friends, Families and the Lover. What Can You Do with This Mpow Smart Wristband?Monitor Sleep QualityConnect it with the App and check your previous day's sleep quality including Deep Sleep Hours, Light Sleep Hours, Awake Sleep Hours, etc. History sleep data can be stored in the App. You will get a better understanding of your sleep quality from your sleep history.Remind You to MoveSimply open "Sedentary Alert" in the App, this smart brace. 【24-hour Fitness Monitor】Track your all-day activities such as distance travelled, steps taken, calorie burned, heart rate, sleep. Connect with mobile's GPS, you can check your real-time route in the App called VeryFitPro. Other sports data and sleep data can be also checked in the App.Check your daily or history heart rate curve in the App "VeryFitPro". Set your heart rate zone according to your personal physical fitness condition.. 【14 Sports Modes】walk, run, bike, workout, yoga, hike, climb, basketball, badminton, tennis, football, treadmill, dynamic bike, dance. Multi-sport modes provide you with a more professional sports data recording method and allow you to get a better understanding of your daily amount of exercise. Get your 24-hour timeline of activities in the App.. 【Receive Notifications】Vibrate to inform you of incoming calls, SMS messages, E-mails, calendar, SNS such as Twitter, Facebook, WhatsApp, Instagram, Linkedin, Flickr, Email, Wechat, QQ, Line, and VK. Add up to 10 alarms in the App at a time for all-day schedule: Get up, take medicine, do a workout, date, attend a meeting, join a party, go to bed, etc. Turn on or off the notifications and alarms both on the screen of the smart band and in the App.. 【Control Music and Camera】Keep it connected with your smartphone via Bluetooth at a range of 10 meters, you can use this Mpow smartwatch to play next song and shoot photos during the workout. Attention: please find "Music Control" and "Camera Shooting" in the App, and then open it.. 【Quick Charge and Long Standby Time】Full charge requires only 1-2 hours and the standby time can be up to 5-10 days with full power when the heart rate function is turned off. No tangled and complicated wires and cords, USB interface allows you to charge it anytime and anywhere..

SmartFitnessTrackerMpowActivityHeartRateMonitor14ExerciseModesSleepGPSRouteTrackingPedometerStepCounterWatchFacesAndroidSmartphones

£40.99

See Offer
Vehicle GPS Tracker Real-time Locator GPS/GSM/GPRS/SMS Tracking Device Motorcycle Car Bike Anti Theft

Vehicle GPS Tracker Real-time Locator GPS/GSM/GPRS/SMS Tracking Device Motorcycle Car Bike Anti Theft

The GPS Vehicle tracker built-in GSM, GPS antenna with low noise and high gain, it supports real-time tracking location information automatically for car/vehicle/motorcycle/bike via SMS, queries on Google map. Specification GSM Frequencies: 850/900/1800/1900 MHz GPRS: Class 12 GPS Sensitivity: -159dBm Acquisition Sensitivity: -144dBm Position Accuracy: 10m GPS positioning time: Cold start -38s (Open sky), Warm start -32s, Hot start -2s (Open sky) GSM/GPS Antenna: Built-in design LED Indicator: G. GPS TRACKER REAL-TIME LOCATOR: Global satellite positioning, real-time tracking, show location information automatically. Getting instructions and location information via SMS, queries on Google map.. ANTI-THEFT AND SEND SOS: This Real-time GPS Tracker can accurately position even when the signal is weak, the car power cable is cut, car battery is stolen or the GPS is removed. WIDELY USE: The real-time vehicle GPS tracking device can be used for tracking location of car/vehicle/motorcycle/bike, nationwide and international coverage using GPS, GPRS, and GSM signal.. PRIVACY PROTECTION: When one person want to make or change any setup,he need a password from you.. SUPPORT ANDROID AND IOS SYSTEM: This GPS navigation tracker supports Android/IOS APP, Web/WAP; power it via the car battery, and insert a new SIM card into it, you can easily to get your car's location..

VehicleGPSTrackerReal-timeLocatorGPS/GSM/GPRS/SMSTrackingDeviceMotorcycleBikeAntiTheft

£16.89

See Offer
GiffGaff Sim Card For GPS Tracking Tracker PAYG GPRS APN Multi Size - Unlimited Calls, Texts, Data - Fits All Devices - £5 Bonus Credit With Your First Top Up Of £10

GiffGaff Sim Card For GPS Tracking Tracker PAYG GPRS APN Multi Size - Unlimited Calls, Texts, Data - Fits All Devices - £5 Bonus Credit With Your First Top Up Of £10

ORIGINAL BRAND NEW SEALED TRIPLE SIM CARD STRAIGHT FROM OUR GIFFGAFF OFFICE. UP TO 3 SIM CARD ORDERS PER PERSON ALSO ACCEPTED £5 FREE CREDIT EACH ON YOUR FIRST TOP UP. Our awesome triple SIM fits all phones (nano, micro and standard sizes). £5 free credit is available on your SIM. Enjoy our rolling monthly bundles from just £5 or pay as you go. 4G data comes as standard on all our plans.-> Keep your Old Numbers. Giffgaff Unlimited texts and internet data - Change your plan from month to month to suit your lifestyle.

GiffGaffCardGPSTrackingTrackerPAYGGPRSAPNMultiSizeUnlimitedCallsTextsDataFitsDevices£5BonusCreditYourFirst£10

£0.01

See Offer
GPS Tracker Genuine Rewire Security 102-NANO Magnetic Car Vehicle Personal Tracking Device

GPS Tracker Genuine Rewire Security 102-NANO Magnetic Car Vehicle Personal Tracking Device

Small & Discreet. The 102-Nano V2 Kit From Rewire Security Keep track of your family members, employees or anyone you need to monitor, with the 102-Nano GPS tracker from Rewire Security, one of the smallest GPS tracking devices available. Even with its small compact design the 102-NANO does not lack on function or features. It's magnetic base allows you to stick it to any metal surface, under your car or on any other asset, just in a matter of seconds. The biggest advantage is that its an all-ro. REAL TIME ONLINE TRACKING : 102-NANO IS SUPPLIED WITH FREE 1 YEAR SUBSCRIPTION TO OUR CLOUD BASED ONLINE TRACKING PANEL GPSLIVE. THE PANEL CAN BE ACCESSED FROM ANY LAPTOP, PC OR EVEN SMARTPHONE USING OUR APP.. VOICE SURVEILLANCE : ONCE THIS FEATURE IS TURNED "ON", IT WILL AUTOMATICALLY ANSWER INCOMING CALLS AND YOU CAN SIMPLY LISTEN THROUGH THE MICROPHONE, JUST LIKE A HANDS-FREE PHONE CALL. 102-NANO IS COMPLETELY SILENT AS IT DOESN'T HAVE A SPEAKER BUILT-IN.. SUITABLE FOR PERSONAL, ASSET, HARD-WIRED AND COVERT TRACKING. IT COMES WITH TWO BACK COVERS, ONE STANDARD PLASTIC AND ONE MAGNETIC COVER FOR METAL SURFACES.. WORKS WITH A PAY AS YOU GO SIM CARD (SUPPLIED) AND THERE AREN'T ANY CONTRACTS OR DIRECT DEBITS YOU HAVE TO PAY. IN LIVE ONLINE TRACKING MODE THE DATA CONSUMPTION IS APPROXIMATELY 6MB PER MONTH. IN SMS TRACKING MODE, YOU SIMPLY PAY AN SMS CHARGE FOR EACH GOOGLE MAPS LINK YOU RECEIVE.. SELF POWERED OR HARD WIRED: 102-NANO CAN BE PERMANENTLY WIRED TO YOUR VEHICLE USING OUR OPTIONAL HARD WIRING KIT BY SIMPLY CONNECTING THE POSITIVE AND NEGATIVE WIRES ON A 9V, 12V OR 24V POWER SOURCE OR BATTERY AND YOU WON'T HAVE TO WORRY ABOUT YOUR TRACKER RUNNING OUT OF BATTERY AGAIN..

GPSTrackerGenuineRewireSecurity102-NANOMagneticVehiclePersonalTrackingDevice

£39.99

See Offer
Zomm - Wireless Leash (Tracking Device) for Mobile Phones, Bluetooth Speakerphone & Personal Safety Device - Black

Zomm - Wireless Leash (Tracking Device) for Mobile Phones, Bluetooth Speakerphone & Personal Safety Device - Black

Zomm - Wireless Leash (Tracking Device) for Mobile Phones, Bluetooth Speakerphone & Personal Safety Device - Black

ZommWirelessLeashTrackingDeviceMobilePhonesBluetoothSpeakerphonePersonalSafetyBlack

$ 40.07

See Offer
Genuine GPS Tracker Car Vehicle Spy Mini Personal Bike Tracking Device TK102B

Genuine GPS Tracker Car Vehicle Spy Mini Personal Bike Tracking Device TK102B

Tiny Genuine Wireless GPS tracker realtime Car Vehicle GPS Tracker Spy Personal Tracking Device TK102 - Free SIM Gps Tracker Wireless Tracking Real Time Magnetic Self Power Gps Tracker Multi Purpose For Car, Motorbike, Asset, Truck, Van, Lorry, Fleet Tracking Genuine Wireless Tracking GPS Tracking Device ALARMS : Shock Sensor Alarm, Movement Alarm, Virtual Geo-Fence Alarm, Door Alarm, SOS Alarm, Overspeed Alarm, SOS Alarm Dual GPS (Global Positioning Sysytem) Tracking and LBS (Location Based Ser

GenuineGPSTrackerVehicleMiniPersonalBikeTrackingDeviceTK102B

£ 35.99

See Offer
GPS TRACKER REWIRE SECURITY 303 FLEET VEHICLE CAR VAN TRACKING DEVICE SYSTEM

GPS TRACKER REWIRE SECURITY 303 FLEET VEHICLE CAR VAN TRACKING DEVICE SYSTEM

See our other items

GPSTRACKERREWIRESECURITY303FLEETVEHICLECARVANTRACKINGDEVICESYSTEM

£ 64.99

See Offer